Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22087 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22087, RRID:AB_10962409
- Product name
- LARP7 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant LARP7.
- Antigen sequence
METESGNQEKVMEEESTEKKKEVEKKKRSRVKQVL
ADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVD
ISLLVSFNKMKKLTTDGKLIARALRSSA- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with LARP7 polyclonal antibody (Cat # PAB22087) at 1-4 ug/mL dilution shows positivity in nucleus and cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine, with LARP7 polyclonal antibody (Cat # PAB22087) shows nuclear positivity in glandular cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)