HPA017600

LARP7 antibody from Sigma-Aldrich
DKFZP564K112, HDCMA18P, PIP7S
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017600, RRID:AB_1850557
Product name
Anti-LARP7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017600
Antibody type
Polyclonal
Antigen
La-related protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GERPKDEDERTVYVELLPKNVNHSWIERVFGKCGN
VVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEF
LNNPPEEAPRKP
Storage
-20C
Provider Type Product Number
- No reagents -