HPA004922

PROM1 antibody from Sigma-Aldrich
AC133, CD133, CORD12, MCDR2, PROML1, RP41, STGD4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004922
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004922, RRID:AB_1846238
Product name
Anti-PROM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004922
Antibody type
Polyclonal
Antigen
Prominin-1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPV
LDEIKSMATAIKETKEALENMNSTLKSLHQQSTQL
SSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLS
LS
Storage
-20C
Provider Type Product Number
- No reagents -