HPA031053

PROM1 antibody from MilliporeSigma / Merck KGaA
AC133, CD133, CORD12, MCDR2, PROML1, RP41, STGD4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031053
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-PROM1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031053
Antibody type
Polyclonal
Antigen
prominin 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAY
DLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLP
IEQSLSTLYQSVKILQRTGNGLLERVTRILASLDF
AQNFITNNTSSVIIEETKKYGRTII
Storage
-20C
Provider Type Product Number
- No reagents -