Antibody data

Product number
H00146223-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00146223-M02, RRID:AB_1112651
Product name
CMTM4 monoclonal antibody (M02), clone 1B9
Provider product page
Abnova Corporation - H00146223-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CMTM4.
Antigen sequence
QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLD
TFSYSTNVTVRKKSPTNLLSLNHWQLA
Isotype
IgG
Antibody clone number
1B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -