HPA014704

CMTM4 antibody from Sigma-Aldrich
CKLFSF4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014704
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014704, RRID:AB_1847005
Product name
Anti-CMTM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014704
Antibody type
Polyclonal
Antigen
CKLF-like MARVEL transmembrane domain-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDT
FSYSTNVTVRKKSPTNLLSLNHWQ
Storage
-20C
Provider Type Product Number
- No reagents -