HPA025925

PLEKHF1 antibody from Atlas Antibodies
APPD, MGC4090, PHAFIN1, ZFYVE15
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025925
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025925, RRID:AB_1844958
Product name
Anti-PLEKHF1
Provider product page
Atlas Antibodies - HPA025925
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MVDHLANTEINSQRIAAVESCFGASGQPLALPGRV
LLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLN
KRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTA
KKSFVVSAASATERQEWISHIEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -