HPA025925

PLEKHF1 antibody from Sigma-Aldrich
APPD, MGC4090, PHAFIN1, ZFYVE15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025925
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025925, RRID:AB_1844958
Product name
Anti-PLEKHF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025925
Antibody type
Polyclonal
Antigen
Pleckstrin homology domain-containing family F member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVDHLANTEINSQRIAAVESCFGASGQPLALPGRV
LLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLN
KRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTA
KKSFVVSAASATERQEWISHIEE
Storage
-20C
Provider Type Product Number
- No reagents -