HPA005682

QSER1 antibody from Sigma-Aldrich
FLJ21924
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005682
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005682, RRID:AB_1855985
Product name
Anti-QSER1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005682
Antibody type
Polyclonal
Antigen
Glutamine and serine-rich protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQHIETPGQNIPTKVTSAVVGPSHEVQEQSSGPFK
KQSATNLESEEDSEAPVDSTLNNNRNQEFVSSSRS
ISGESATSESEFTLGGDDSGVSMNPARSALALLAM
AQSGDAVSVKIEEENQDLMHFNLQKKRAKGKGQVK
Storage
-20C
Provider Type Product Number
- No reagents -