Antibody data

Product number
HPA026521
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026521, RRID:AB_2106163
Product name
Anti-FNDC8
Provider product page
Atlas Antibodies - HPA026521
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AVLKKENFNMMNALDQLPKPFPNPKSMNRTVTTKG
LPLASKGNLVNFLEDDTINLLKPLPVEDSDCSSDE
TSISAFSSTLLNPIKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.