HPA018807

NLE1 antibody from Sigma-Aldrich
FLJ10458
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018807
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018807, RRID:AB_1848658
Product name
Anti-NLE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018807
Antibody type
Polyclonal
Antigen
Notchless protein homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALR
TGAFEPAEASVNPQDLQGSLQELKERALSRYNLVR
GQGPERLVSGSDDFTL
Storage
-20C
Provider Type Product Number
- No reagents -