HPA018807

NLE1 antibody from Atlas Antibodies
FLJ10458
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018807
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018807, RRID:AB_1668883
Product name
Anti-NLE1
Provider product page
Atlas Antibodies - HPA018807
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALR
TGAFEPAEASVNPQDLQGSLQELKERALSRYNLVR
GQGPERLVSGSDDFTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -