Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109590 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 436 (ZNF436) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF436 antibody: synthetic peptide directed towards the N terminal of human ZNF436.
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
RQWGDLTAEEWVSYPLQPVTDLLVHKEVHTGIRYH
ICSHCGKAFSQISDL- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-ZNF436 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate; ZNF436 antibody - N-terminal region (AP42231PU-N) in Human HepG2 cells using Western Blot