AV33651

ZNF436 antibody from MilliporeSigma / Merck KGaA
KIAA1710, Zfp46
No application information provided.

Antibody data

Product number
AV33651
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV33651, RRID:AB_1859267
Product name
Anti-ZNF436 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV33651
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF436 with an internal ID of P04713
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
DLTAEEWVSYPLQPVTDLLVHKEVHTGIRYHICSH
CGKAFSQISDLNRHQ
Storage
-20C
Provider Type Product Number
- No reagents -