HPA008310

MCCC1 antibody from Sigma-Aldrich
MCCA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008310
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008310, RRID:AB_1853620
Product name
Anti-MCCC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008310
Antibody type
Polyclonal
Antigen
Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITGTDLVEWQLRIAAGEKIPLSQEEITLQGHAFEA
RIYAEDPSNNFMPVAGPLVHLSTPRADPSTRIETG
VRQGDEVSVHYDPMIAKLVVWAADRQAALTKLRYS
LRQYNIVGLHTNIDFLLNLSGHPEFEAGNVHTDFI
PQHH
Storage
-20C
Provider Type Product Number
- No reagents -