H00011214-M01
antibody from Abnova Corporation
Targeting: AKAP13
AKAP-Lbc, ARHGEF13, BRX, c-lbc, HA-3, Ht31, LBC, PROTO-LB
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011214-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011214-M01, RRID:AB_464297
- Product name
- AKAP13 monoclonal antibody (M01), clone 5B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AKAP13.
- Antigen sequence
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLV
FLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKV
QLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLAT
SAGNQ- Isotype
- IgG
- Antibody clone number
- 5B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The mRNA and protein expression of A-kinase anchor proteins 13 in human colorectal cancer.
Hu JK, Wang L, Li Y, Yang K, Zhang P, Chen XZ, Wang R, Zhou ZG
Clinical and experimental medicine 2010 Mar;10(1):41-9
Clinical and experimental medicine 2010 Mar;10(1):41-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AKAP13 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to AKAP13 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol