H00011214-M10
antibody from Abnova Corporation
Targeting: AKAP13
AKAP-Lbc, ARHGEF13, BRX, c-lbc, HA-3, Ht31, LBC, PROTO-LB
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011214-M10 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011214-M10, RRID:AB_622266
- Product name
- AKAP13 monoclonal antibody (M10), clone 3D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AKAP13.
- Antigen sequence
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLV
FLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKV
QLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLAT
SAGNQ- Isotype
- IgG
- Antibody clone number
- 3D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AKAP13 monoclonal antibody (M10), clone 3D6. Western Blot analysis of AKAP13 expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AKAP13 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to AKAP13 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol