HPA012047

OXCT1 antibody from Sigma-Aldrich
OXCT, SCOT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012047
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012047, RRID:AB_1854857
Product name
Anti-OXCT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012047
Antibody type
Polyclonal
Antigen
Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVD
NFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGE
LEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLV
QEGGSPIKYNKDGSVAIASKPREVREFNGQHFILE
EAITGDF
Storage
-20C
Provider Type Product Number
- No reagents -