HPA012047

OXCT1 antibody from Atlas Antibodies
OXCT, SCOT
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012047
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012047, RRID:AB_1854857
Product name
Anti-OXCT1
Provider product page
Atlas Antibodies - HPA012047
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVD
NFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGE
LEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLV
QEGGSPIKYNKDGSVAIASKPREVREFNGQHFILE
EAITGDF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -