Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007536-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007536-M01, RRID:AB_607016
- Product name
- SF1 monoclonal antibody (M01), clone 2E12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SF1.
- Antigen sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPG
MPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDL
GIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKL
EEERH- Isotype
- IgG
- Antibody clone number
- 2E12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SF1 expression in transfected 293T cell line by SF1 monoclonal antibody (M01), clone 2E12.Lane 1: SF1 transfected lysate (Predicted MW: 59.7 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SF1 monoclonal antibody (M01), clone 2E12. Western Blot analysis of SF1 expression in NIH/3T3.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SF1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SF1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of SF1 transfected lysate using anti-SF1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SF1 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SF1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol