HPA019950

PDP2 antibody from Sigma-Aldrich
KIAA1348, PPM2B, PPM2C2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019950
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019950, RRID:AB_1855156
Product name
Anti-AC044802.7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019950
Antibody type
Polyclonal
Antigen
No description available in Ensembl
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGL
MQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYG
E
Storage
-20C
Provider Type Product Number
- No reagents -