Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000817-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000817-M02, RRID:AB_606013
- Product name
- CAMK2D monoclonal antibody (M02), clone 1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CAMK2D.
- Antigen sequence
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSN
TTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYT
KICDPGLTAFEPEALGNLVEGMDFHRFYFENALSK
SNKPI- Isotype
- IgG
- Antibody clone number
- 1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CAMK2D expression in transfected 293T cell line by CAMK2D monoclonal antibody (M02), clone 1A8.Lane 1: CAMK2D transfected lysate(54.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CAMK2D on NIH/3T3 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol