HPA026281

CAMK2D antibody from MilliporeSigma / Merck KGaA
CAMKD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026281
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-CAMK2D antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026281
Antibody type
Polyclonal
Antigen
Calcium/calmodulin-dependent protein kinase type II delta chain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGS
PTVPIKPPCIPNGKENFSGGTSLWQ
Storage
-20C