HPA023030

SLFN11 antibody from Atlas Antibodies
FLJ34922
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023030
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023030, RRID:AB_1856613
Product name
Anti-SLFN11
Provider product page
Atlas Antibodies - HPA023030
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQP
QRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAV
FSEAPNSWI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -