HPA023030

SLFN11 antibody from Sigma-Aldrich
FLJ34922
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023030
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023030, RRID:AB_1856613
Product name
Anti-SLFN11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023030
Antibody type
Polyclonal
Antigen
Schlafen family member 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQP
QRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAV
FSEAPNSWI
Storage
-20C
Provider Type Product Number
- No reagents -