Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008824-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008824-M02, RRID:AB_565579
- Product name
- CES2 monoclonal antibody (M02), clone 4F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CES2.
- Antigen sequence
PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLS
RKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQ
LNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEE
RHT- Isotype
- IgG
- Antibody clone number
- 4F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Clinical implications of CES2 RNA expression in neuroblastoma.
Human carboxylesterase-2 hydrolyzes the prodrug of gemcitabine (LY2334737) and confers prodrug sensitivity to cancer cells.
Uchida K, Otake K, Tanaka K, Hashimoto K, Saigusa S, Matsushita K, Koike Y, Inoue M, Ueeda M, Okugawa Y, Inoue Y, Mohri Y, Kusunoki M
Journal of pediatric surgery 2013 Mar;48(3):502-9
Journal of pediatric surgery 2013 Mar;48(3):502-9
Human carboxylesterase-2 hydrolyzes the prodrug of gemcitabine (LY2334737) and confers prodrug sensitivity to cancer cells.
Pratt SE, Durland-Busbice S, Shepard RL, Heinz-Taheny K, Iversen PW, Dantzig AH
Clinical cancer research : an official journal of the American Association for Cancer Research 2013 Mar 1;19(5):1159-68
Clinical cancer research : an official journal of the American Association for Cancer Research 2013 Mar 1;19(5):1159-68
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CES2 monoclonal antibody (M02), clone 4F12 Western Blot analysis of CES2 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CES2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CES2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
