H00008824-M03

CES2 antibody from Abnova Corporation
CE-2, CES2A1, iCE

Antibody data

Product number
H00008824-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008824-M03, RRID:AB_1112265
Product name
CES2 monoclonal antibody (M03), clone 4E3
Provider product page
Abnova Corporation - H00008824-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CES2.
Antigen sequence
PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLS
RKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQ
LNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEE
RHT
Isotype
IgG
Antibody clone number
4E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -