HPA018897

CES2 antibody from Sigma-Aldrich
CE-2, CES2A1, iCE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018897
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018897, RRID:AB_1846558
Product name
Anti-CES2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018897
Antibody type
Polyclonal
Antigen
Carboxylesterase 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREAS
QAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTL
QAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEF
QHQP
Storage
-20C
Provider Type Product Number
- No reagents -