HPA018897

CES2 antibody from Atlas Antibodies
CE-2, CES2A1, iCE
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018897
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018897, RRID:AB_1846558
Product name
Anti-CES2
Provider product page
Atlas Antibodies - HPA018897
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREAS
QAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTL
QAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEF
QHQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -