HPA003136

BBOF1 antibody from Atlas Antibodies
C14orf45, CCDC176
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003136
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003136, RRID:AB_1078330
Product name
Anti-BBOF1
Provider product page
Atlas Antibodies - HPA003136
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ISRKHYKQIAQAAFNLKMRAACTGRTEYPKIRTFD
GREHSTNSVNQDLLEAEKWTHIEGNVDIGDLTWEQ
KEKVLRLLFAKMNGCPSRKYNQSSRPPVPDYVVSD
SGETKEFGDESKLQDKIFITQQIAISDSSGEVVLP
TIPKEPQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -