Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182904 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kinesin Family Member 3B (KIF3B) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KIF3B antibody: synthetic peptide directed towards the C terminal of human KIF3B
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
APKVQAALDAALQDEDEIQVDASSFESTANKKSKA
RPKSG RKSGSSSSSS- Vial size
- 50 µg
Submitted references Identification of genes that are linked with optineurin expression using a combined RNAi--microarray approach.
Identification of a link between the tumour suppressor APC and the kinesin superfamily.
Weisschuh N, Alavi MV, Bonin M, Wissinger B
Experimental eye research 2007 Oct;85(4):450-61
Experimental eye research 2007 Oct;85(4):450-61
Identification of a link between the tumour suppressor APC and the kinesin superfamily.
Jimbo T, Kawasaki Y, Koyama R, Sato R, Takada S, Haraguchi K, Akiyama T
Nature cell biology 2002 Apr;4(4):323-7
Nature cell biology 2002 Apr;4(4):323-7
No comments: Submit comment
No validations: Submit validation data