HPA007119

KIF3B antibody from MilliporeSigma / Merck KGaA
FLA8, KIAA0359, KLP-11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007119
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007119, RRID:AB_1852498
Product name
Anti-KIF3B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007119
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF3B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IMNRAFFDEEEDHWKLHPITRLENQQMMKRPVSAV
GYKRPLSQHARMSMMIRPEARYRAENIVLLELDMP
SRTTRDYEGPAIAPKVQAALDAALQDEDEIQVDAS
SFESTANKKSKARPKSGRKSGSSSSSSGTPASQLY
PQSR
Storage
-20C
Provider Type Product Number
- No reagents -