HPA022532

SLFN13 antibody from Sigma-Aldrich
FLJ31952
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022532
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022532, RRID:AB_1856615
Product name
Anti-SLFN13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022532
Antibody type
Polyclonal
Antigen
Schlafen family member 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLGCAKEQVDPDSLKNVIARAISKLPIVHFCSSKP
RVEYSTKIVEVFCGKELYGYLCVIKVKAFCCVVFS
EAPK
Storage
-20C
Provider Type Product Number
- No reagents -