Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486808 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Lipase, Endothelial (LIPG) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LIPG antibody: synthetic peptide directed towards the middle region of human LIPG
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRD
GWRMK NETSPTVELP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
Willer CJ, Sanna S, Jackson AU, Scuteri A, Bonnycastle LL, Clarke R, Heath SC, Timpson NJ, Najjar SS, Stringham HM, Strait J, Duren WL, Maschio A, Busonero F, Mulas A, Albai G, Swift AJ, Morken MA, Narisu N, Bennett D, Parish S, Shen H, Galan P, Meneton P, Hercberg S, Zelenika D, Chen WM, Li Y, Scott LJ, Scheet PA, Sundvall J, Watanabe RM, Nagaraja R, Ebrahim S, Lawlor DA, Ben-Shlomo Y, Davey-Smith G, Shuldiner AR, Collins R, Bergman RN, Uda M, Tuomilehto J, Cao A, Collins FS, Lakatta E, Lathrop GM, Boehnke M, Schlessinger D, Mohlke KL, Abecasis GR
Nature genetics 2008 Feb;40(2):161-9
Nature genetics 2008 Feb;40(2):161-9
No comments: Submit comment
No validations: Submit validation data