ABIN486808

LIPG antibody from antibodies-online
EDL
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN486808
Provider
antibodies-online
Product name
anti-Lipase, Endothelial (LIPG) (Middle Region) antibody
Provider product page
antibodies-online - ABIN486808
Antibody type
Polyclonal
Antigen
The immunogen for anti-LIPG antibody: synthetic peptide directed towards the middle region of human LIPG
Description
Affinity Purified
Reactivity
Human, Mouse, Bovine, Canine, Rabbit
Host
Rabbit
Antigen sequence
VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRD
GWRMK NETSPTVELP
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -