HPA016966

LIPG antibody from Sigma-Aldrich
EDL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016966
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016966, RRID:AB_1852893
Product name
Anti-LIPG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016966
Antibody type
Polyclonal
Antigen
Endothelial lipase Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSV
GHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLH
KLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNT
RVVGHSIARMLDWLQEKDDFSLGNVHLIGYS
Storage
-20C
Provider Type Product Number
- No reagents -