HPA020235

PEX1 antibody from Atlas Antibodies
ZWS, ZWS1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020235
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020235, RRID:AB_1855224
Product name
Anti-PEX1
Provider product page
Atlas Antibodies - HPA020235
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQ
ELTQEQRDQLRADISIIKGRYRSQSGEDESMNQPG
PIKTRLAISQSHLMTALGHTRPSISEDDWKNFAEL
YESFQNPKRRKNQSGTMFRPG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -