HPA020235

PEX1 antibody from Sigma-Aldrich
ZWS, ZWS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020235
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020235, RRID:AB_1855224
Product name
Anti-PEX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020235
Antibody type
Polyclonal
Antigen
Peroxisome biogenesis factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQ
ELTQEQRDQLRADISIIKGRYRSQSGEDESMNQPG
PIKTRLAISQSHLMTALGHTRPSISEDDWKNFAEL
YESFQNPKRRKNQSGTMFRPG
Storage
-20C
Provider Type Product Number
- No reagents -