HPA023450

KLHL25 antibody from Atlas Antibodies
ENC-2, ENC2, FLJ12587
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023450
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023450, RRID:AB_1852583
Product name
Anti-KLHL25
Provider product page
Atlas Antibodies - HPA023450
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HFETVRQSEDFNSLSKDTLLDLISSDELETEDERV
VFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSD
CLQEAVSSEALLMADERTKLIMDEALRCKTRILQN
DGVVTSPCA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -