HPA023450

KLHL25 antibody from Sigma-Aldrich
ENC-2, ENC2, FLJ12587
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023450
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023450, RRID:AB_1852583
Product name
Anti-KLHL25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023450
Antibody type
Polyclonal
Antigen
Ectoderm-neural cortex protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HFETVRQSEDFNSLSKDTLLDLISSDELETEDERV
VFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSD
CLQEAVSSEALLMADERTKLIMDEALRCKTRILQN
DGVVTSPCA
Storage
-20C
Provider Type Product Number
- No reagents -