H00060685-M03

ZFAND3 antibody from Abnova Corporation
FLJ13222, TEX27
No application information provided.

Antibody data

Product number
H00060685-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00060685-M03, RRID:AB_1582008
Product name
ZFAND3 monoclonal antibody (M03), clone 2D2
Provider product page
Abnova Corporation - H00060685-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZFAND3.
Antigen sequence
GDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCF
ADFQKKQPDDDSAPSTSNSQSDLF
Isotype
IgG
Antibody clone number
2D2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -