HPA016755

ZFAND3 antibody from Sigma-Aldrich
FLJ13222, TEX27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016755
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016755, RRID:AB_1859011
Product name
Anti-ZFAND3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016755
Antibody type
Polyclonal
Antigen
AN1-type zinc finger protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKC
FADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNN
TSITTPTLSP
Storage
-20C
Provider Type Product Number
- No reagents -