Antibody data

Product number
ABIN502901
Provider
antibodies-online
Product name
anti-G Protein-Coupled Receptor 27 (GPR27) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502901
Antibody type
Polyclonal
Antigen
The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27
Description
Affinity Purified
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTA
SVWLT FAQAGINPVV
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -