Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502901 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-G Protein-Coupled Receptor 27 (GPR27) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTA
SVWLT FAQAGINPVV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references An evolutionarily conserved G-protein coupled receptor family, SREB, expressed in the central nervous system.
Matsumoto M, Saito T, Takasaki J, Kamohara M, Sugimoto T, Kobayashi M, Tadokoro M, Matsumoto S, Ohishi T, Furuichi K
Biochemical and biophysical research communications 2000 Jun 7;272(2):576-82
Biochemical and biophysical research communications 2000 Jun 7;272(2):576-82
No comments: Submit comment
No validations: Submit validation data