HPA011739

PARP4 antibody from Sigma-Aldrich
ADPRTL1, p193, VAULT3, VPARP, VWA5C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011739
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011739, RRID:AB_1854986
Product name
Anti-PARP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011739
Antibody type
Polyclonal
Antigen
Poly recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHM
LLKPVNRISLNDVSKAEGILLLVKAALKNGETAEQ
LQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQ
LIRDMVNVCETNLSKPNPPSLAKYRALRCKIEHVE
QNTEEF
Storage
-20C
Provider Type Product Number
- No reagents -