Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90704 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90704, RRID:AB_2665637
- Product name
- Anti-FLT1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEI
TIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVP
EPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTE
EDEGVYHCKATNQKGS- Epitope
- Binds to an epitope located within the peptide sequence EPQITWFKNN as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0345
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line RT-4
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and tonsil tissues using AMAb90704 antibody. Corresponding FLT1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong immunoreactivity in the endothelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong positivity in the endothelial cells and smooth muscle cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows positivity in the endothelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows immunoreactivity in the endothelium and smooth muscle cells of blood vessels, as well as in renal glomeruli and tubuli cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in endothelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in endothelial cells, as well as positivity in smooth muscle cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.