Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA011740 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-FLT1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEI
TIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVP
EPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTE
EDEGVYHCKATNQKGS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
Halting angiogenesis by non-viral somatic gene therapy alleviates psoriasis and murine psoriasiform skin lesions
Kim K, Bachmann J, Burté F, Pramana S, Conte I, Brown B, Orimadegun A, Ajetunmobi W, Afolabi N, Akinkunmi F, Omokhodion S, Akinbami F, Shokunbi W, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk J, Wahlgren M, Fernandez-Reyes D, Nilsson P
PLoS Pathogens 2014;10(4):e1004038
PLoS Pathogens 2014;10(4):e1004038
Halting angiogenesis by non-viral somatic gene therapy alleviates psoriasis and murine psoriasiform skin lesions
Zibert J, Wallbrecht K, Schön M, Mir L, Jacobsen G, Trochon-Joseph V, Bouquet C, Villadsen L, Cadossi R, Skov L, Schön M
Journal of Clinical Investigation 2011;121(1):410-421
Journal of Clinical Investigation 2011;121(1):410-421
No comments: Submit comment
No validations: Submit validation data