HPA014290

FLT1 antibody from Sigma-Aldrich
FLT, VEGFR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014290
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014290, RRID:AB_1858738
Product name
Anti-FLT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014290
Antibody type
Polyclonal
Antigen
Vascular endothelial growth factor receptor 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTN
YLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTA
TTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHA
N
Storage
-20C
Provider Type Product Number
- No reagents -