HPA006871

CMC2 antibody from Sigma-Aldrich
C16orf61, DC13, MGC45036
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006871
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006871, RRID:AB_1845581
Product name
Anti-C16orf61 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006871
Antibody type
Polyclonal
Antigen
Uncharacterized protein C16orf61 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFG
YCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL
Storage
-20C
Provider Type Product Number
- No reagents -