HPA021319

SAMD9 antibody from Atlas Antibodies
C7orf5, FLJ20073, KIAA2004
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021319
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021319, RRID:AB_1856554
Product name
Anti-SAMD9
Provider product page
Atlas Antibodies - HPA021319
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAKQLNLPENTDDWTKEDVNQWLESHKIDQKHREI
LTEQDVNGAVLKWLKKEHLVDMGITHGPAIQIEEL
FKELRKTAIEDS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -