PAB21389

SAMD9 antibody from Abnova Corporation
C7orf5, FLJ20073, KIAA2004

Antibody data

Product number
PAB21389
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21389, RRID:AB_10968563
Product name
SAMD9 polyclonal antibody
Provider product page
Abnova Corporation - PAB21389
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SAMD9.
Antigen sequence
MAKQLNLPENTDDWTKEDVNQWLESHKIDQKHREI
LTEQDVNGAVLKWLKKEHLVDMGITHGPAIQIEEL
FKELRKTAIEDS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -