HPA021318

SAMD9 antibody from Sigma-Aldrich
C7orf5, FLJ20073, KIAA2004
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021318
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021318, RRID:AB_2183383
Product name
Anti-SAMD9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021318
Antibody type
Polyclonal
Antigen
Sterile alpha motif domain-containing protein 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSQKERRETSKQKQKGKENPDMANPSAMSTTAKGS
KSLKVELIEDKIDYTKERQPSIDLTCVSYPFDEFS
NPYRYKLDFSLQP
Storage
-20C
Provider Type Product Number
- No reagents -